Skip to main content

Pressmeddelanden Visa alla 7 träffar

Svensk Broccoloco finns nu ute i din butik!

Svensk Broccoloco finns nu ute i din butik!

Pressmeddelanden   •   Jun 27, 2018 12:51 CEST

​I förra veckan skördade Håkan Paulsson på Bjärehalvön och Håkan Nilsson i Sölvesborg den första svenska Broccolocon för i år! Vi på Grönsaksmästarna väntade ivrigt på första leveransen då vi sett fram emot premiären. Broccoloco är enligt oss på Grönsaksmästarna helt enkelt en godare broccoli.

Det våras för östgötachampinjonerna, nu lanseras D-vitaminberikad svamp på ICA!

Det våras för östgötachampinjonerna, nu lanseras D-vitaminberikad svamp på ICA!

Pressmeddelanden   •   Maj 07, 2018 10:50 CEST

I över två år har Östgötasvamp arbetat med ett system för att berika svampar med D-vitamin. Inspirationen kommer direkt från naturen, och likt solens strålar har företaget använt sig av UV-lampor som berikar svamparna med vitaminet. Nu lanseras de D-vitaminberikade champinjonen i ICA-butiker runt om i landet. Bredvid dem hittar kunden även EKO Champinjoner och EKO Kastanjechampinjoner.

Fiorina®, milda och söta blomkålsbuketter med många användningsområden!

Fiorina®, milda och söta blomkålsbuketter med många användningsområden!

Pressmeddelanden   •   Mar 02, 2018 11:05 CET

Nyheten provodlades hos flera odlare på Bjärehalvön sommaren 2017 och såldes i liten skala av oss på Grönsaksmästarna. Produkten blev väl mottagen av marknaden och Grönsaksmästarna har därför fortsatt satsa på produkten och importerar den nu. Tillsammans med två svenska odlare på Bjäre har nu Grönsaksmästarna planerat en ökad volym sommaren 2018 för att kunna tillgodose marknadens efterfrågan.

Broccoloco®, en mildare och sötare broccoli med läckra stjälkar!

Broccoloco®, en mildare och sötare broccoli med läckra stjälkar!

Pressmeddelanden   •   Jan 29, 2018 09:33 CET

Broccoloco®, en mildare och sötare broccoli med långa och goda stjälkar som påminner om den söta sparrisbroccolin Bellaverde i smaken. Förra sommaren provodlades Broccoloco på Listerlandet och efter att vi fått in de första huvudena till oss på Grönsaksmästarna så såg vi genast potentialen i produkten. Nu odlar vi produkten i Spanien och responsen från kunderna som köpt produkten är mycket bra!

Nyheter 4 träffar

Butikstävling! Butkerna har en chans att vinna ett festligt event i cosmopolitans anda värt 30 000kr!

Butikstävling! Butkerna har en chans att vinna ett festligt event i cosmopolitans anda värt 30 000kr!

Nyheter   •   Nov 07, 2016 10:16 CET

Butikstävlingen drar igång idag, följ tävlingen på eller under hashtaggen #cosmopolitanexpo på Instagram! Butikerna tävlar om ett festligt event i Cosmopolitans anda värt 30 000kr! Butikerna ska exponera cosmopolitansallaten så snyggt de bara kan och sedan lägga ut en bild på deras bästa exponering på Instagram där du kan rösta fram din favorit!

Cosmopolitansallaten har nu fått en egen hemsida! Där  kan ni följa Cosmopolitansallaten i sociala medier, ta del av inspirerande recept och i framtiden kommer ni att kunna delta i tävlingar där ni kan vinna helt otroliga priser!

Cosmopolitansallaten har nu fått en egen hemsida! Där kan ni följa Cosmopolitansallaten i sociala medier, ta del av inspirerande recept och i framtiden kommer ni att kunna delta i tävlingar där ni kan vinna helt otroliga priser!

Nyheter   •   Aug 29, 2016 10:57 CEST

På hemsidan kan ni följa Cosmopolitansallaten i sociala medier, ta del av inspirerande recept och i framtiden kommer ni att kunna delta i tävlingar där ni kan vinna helt otroliga priser! :D Varför inte gå in och kika på hemsidan redan nu? Ni hittar säkert inspiration till kvällens middag! Cosmopolitansallaten, världens godaste sallat?

Se vår vackra film från Bjärehalvön och få en inblick i hur den lyxiga Cosmopolitansalladen skördas och packas!

Nyheter   •   Jul 08, 2016 12:40 CEST

Cosmopolitan är en söt och krispig sallat. Den söta smaken och enastående krispigheten har uppkommit genom traditionell växtförädling där man kombinerat isbergssallatens och romansallatens bästa egenskaper. Cosmopolitan håller sig krispig och vacker länge, därför är den också populär bland yrkeskockar! Se vår Cosmopolitan-film och få en inblick i hur den lyxiga salladen skördas och packas!

Superbroccolin uppmärksammas internationellt!

Superbroccolin uppmärksammas internationellt!

Nyheter   •   Feb 14, 2014 16:37 CET

Association of European Science and Technology Transfer Professionals ASTP har valt ut Superbroccolin, eller Beneforte som den oftast kallas utomlands, som en av fjorton produkter som visat sig särskilt framgångsrika och som är goda representanter för forskning som kommit allmänheten till godo.

Blogginlägg Visa alla 41 träffar

Cosmopolitansallat, en ny variant av sushi!

Cosmopolitansallat, en ny variant av sushi!

Blogginlägg   •   Dec 03, 2018 08:00 CET

Älskar du sushi? Här är en ny god variant! Gott småplock till maten, till kvällsmyset eller som en fräsch lunch!

Cosmopolitansallaten, ett fräscht och gott tacoskal!

Cosmopolitansallaten, ett fräscht och gott tacoskal!

Blogginlägg   •   Nov 30, 2018 15:00 CET

Vi rekommenderar att testa ett krispigt salladsblad som tacoskal! Fräscht, gott och nyttigt! Cosmopolitansallaten är enligt oss det självklara valet med sina fasta, söta och krispiga blad!

En god paj med grönkålsgroddar!

En god paj med grönkålsgroddar!

Blogginlägg   •   Nov 19, 2018 15:00 CET

Sugen på en paj med svenska ekologiska grönkålsgroddar till middag? Svenska groddar året runt från Nyttogrönt!

Cosmopolitansallat, perfekt som hamburgarbröd eller tacoskal!

Cosmopolitansallat, perfekt som hamburgarbröd eller tacoskal!

Blogginlägg   •   Nov 12, 2018 15:00 CET

Har ni testat att byta ut hamburgarbrödet mot salladsblad från #cosmopolitansalladen? Supergott! Bladen på en cosmopolitansallat är fasta, vackra, goda och krispiga! Alltså perfekta som tacoskal eller hamburgarbröd! God som vegetarisk med t.ex. halloumi!

Bilder Visa alla 116 träffar

Hokkaido pumpa

Hokkaido pumpa

Licens Creative Commons erkännande
Ladda ner

511 KB • 1024 x 683 px

Butternut Pumpa

Butternut Pumpa

Licens Creative Commons erkännande
Ladda ner

363 KB • 1024 x 683 px

Kåseberga gård

Kåseberga gård

Licens Creative Commons erkännande
Ladda ner

4,51 MB • 5760 x 3840 px



Licens Creative Commons erkännande
Ladda ner

4,68 MB • 4861 x 3241 px

Videor 1 träff

IFR förklarar hur Superbroccolin fungerar i kroppen!

IFR förklarar hur Superbr...

IFRs film som beskriver hur Superbroccolins glucoraphanin arbetar i kroppen.

Licens Creative Commons erkännande
Ladda ner

17,9 MB • 854 x 480 px

Dokument Visa alla 7 träffar

Skylt att använda i butik

Skylt att använda i butik

Dokument   •   2018-06-27 12:51 CEST

Skylt att använda i butik

Skylt att använda i butik

Dokument   •   2018-06-27 12:51 CEST

Skylt att använda i butik

Skylt att använda i butik

Dokument   •   2018-06-27 12:51 CEST

Skylt att använda i butik

Skylt att använda i butik

Dokument   •   2018-06-27 12:51 CEST

Kontaktpersoner 1 träff

  • Presskontakt
  • Marknadsansvarig
  • Marknad
  • viijctwqordl@gljroobnseiakmqsmpvasphtamqrnfka.tqsend
  • +46426000538