Skip to main content

Pressmeddelanden Visa alla 92 träffar



Pressmeddelanden   •   Dec 13, 2018 10:28 CET

To celebrate over a decade of the unrivalled Bols Around The World competition, Lucas Bols is mixing things up in 2019 by inviting bar teams to participate. Because at the end of the day, it takes a talented team to create a remarkable cocktail experience.

Rättelse gällande kvantitet - The MACALLAN Exceptional single cask lanseras idag

Rättelse gällande kvantitet - The MACALLAN Exceptional single cask lanseras idag

Pressmeddelanden   •   Okt 11, 2018 09:19 CEST

The Macallan presenterar Exceptional Single Cask – en unik samling Single Cask whiskys som representerar den mångfald i uttryck som ryms inom The Macallan. Systembolaget har fått äran att lansera den 13:e whiskyn i den globala serien, en unik 14-årig single malt i en limiterad upplaga om 48 flaskor.

The MACALLAN Exceptional single cask  lanseras imorgon - Rättelse gällande kvantitet

The MACALLAN Exceptional single cask lanseras imorgon - Rättelse gällande kvantitet

Pressmeddelanden   •   Okt 10, 2018 14:30 CEST

The Macallan presenterar Exceptional Single Cask – en unik samling Single Cask whiskys som representerar den mångfald i uttryck som ryms inom The Macallan. Systembolaget har fått äran att lansera den 13:e whiskyn i den globala serien, en unik 14-årig single malt i en limiterad upplaga om 48 flaskor.

Highland Park introducerar THE LIGHT

Highland Park introducerar THE LIGHT

Pressmeddelanden   •   Okt 10, 2018 09:00 CEST

Highland Park presenterar stolt sin senaste lansering THE LIGHT – efterföljaren till den tidigare releasen THE DARK och den sista lanseringen i en serie om två. Highland Park THE LIGHT är en 17-årig single malt whisky lagrad på amerikanska ekfat, med ljus och klar färg bjuder THE LIGHT på en distinkt och spännande smak med tydlig karaktär och inslag av ljungtorv, muskotnöt och vanilj.

Nyheter Visa alla 23 träffar

Ett skepp kommer lastat! Med prisvärd maltwhisky - exklusivt framtagen för den svenska marknaden

Ett skepp kommer lastat! Med prisvärd maltwhisky - exklusivt framtagen för den svenska marknaden

Nyheter   •   Feb 03, 2017 17:19 CET

​Anchor 10 y.o. peated edition är en blended malt whisky som lanseras den 1 mars på samtliga landets Systembolagsbutiker. Produkten är exklusivt framtagen för den svenska marknaden där Kirsteen Campbell, Master Blender på The Edrington Group valt ut faten som ingår i denna blended malt som har lagrats minst 10 år på återanvända (s.k. refill) sherryfat.

Wine Spectator awards the outstanding elegance and the refinement of Piper-Heidsieck!

Wine Spectator awards the outstanding elegance and the refinement of Piper-Heidsieck!

Nyheter   •   Jan 23, 2017 07:56 CET

In its January edition of the newsletter Insider, Wine Spectator gives a very special place to two of Piper-Heidsieck champagnes: Cuvée Brut NV awarded 92 points! Vintage 2008 awarded 93 points!



Nyheter   •   Nov 18, 2016 16:28 CET

Whisky som lagrats på sherryfat med ek från båda sidor av Atlanten. Det sägs ofta att när två världar möts skapas något extraordinärt. För The Macallan är det en sanning som resulterat i deras nya 12-åriga Single Malt: The Macallan Double Cask, som lanseras i Systembolagets fasta sortiment den 1 december 2016.

Highland park lanserar Single Cask exklusivt för Sverige

Nyheter   •   Okt 18, 2016 15:19 CEST

​Det är 11 år sedan sist men nu lanserar Highland Park äntligen en ny Single Cask-serie. Totalt är det tre Single Cask som kommer att lanseras exklusivt i Sverige. Den första utkommer redan torsdagen den 20 oktober och trycket väntas vara mycket högt.

Blogginlägg 1 träff

Bjud dina vänner på somrig bål till midsommar!

Bjud dina vänner på somrig bål till midsommar!

Blogginlägg   •   Jun 16, 2015 08:00 CEST

​Vill du bjuda på något nytt och somrigt till årets mest uppskattade högtid och samtidigt få tid att umgås mer med dina gäster? Bjud på bål! Vi har testat sommarens drinkmåste: Cameron’s Fist.

Bilder Visa alla 235 träffar

Highland Park Full Volume

Highland Park Full Volume

Licens Creative Commons erkännande
Ladda ner

16,5 MB • 6966 x 10448 px

Highland Park Full Volume flaska och förpackning

Highland Park Full Volume...

Licens Creative Commons erkännande
Ladda ner

96,8 KB • 1024 x 1024 px

Highland Park "Bottled for Sweden" II

Highland Park "Bottled fo...

Licens Creative Commons erkännande
Fotograf/Källa Anna Hållams
Ladda ner

10,6 MB • 4928 x 3280 px

Highland Park "Bottled for Sweden"

Highland Park "Bottled fo...

Licens Creative Commons erkännande
Fotograf/Källa Anna Hållams
Ladda ner

12,1 MB • 4928 x 3280 px

Videor 2 träffar

Drinktips - Mamie Taylor

Drinktips - Mamie Taylor

40 ml Naked Grouse, 20 ml Limejuice, Fyll upp med Ginger ale. Både ginger ale och ginger beer passar bra i denna drink, testa och...

Licens Creative Commons erkännande
Ladda ner

854 x 480 px

Be part of something Famous

Be part of something Famous

Licens Creative Commons erkännande
Ladda ner

52,8 MB • 854 x 480 px

Dokument Visa alla 5 träffar

Kontaktpersoner 4 träffar

  • Presskontakt
  • Nordic Brand Manager
  • Lucas Bols
  • miygrjnya.jbpudzlkzckixxneymn@quedgtriywngketordn.sacoclmwt
Key brands Bols Liqueurs, Bols Vodka, Bols Genever, Galliano Liqueurs and Pisang Ambon.

  • Brand Manager
  • jokshaddnnkva.tqmaeilmpvgriqenqa@ervdrujinadgtfponri.cphomrc
  • 0702262260
Ansvarif för Edringtons varumärken: The Famous Grouse, Highland Park, The Macallan, Cutty Sark, Anchor, Brugal.

  • Head of Business Development
  • mazwrcsausru.bxyraeyndwp@emsdrobinpigtudonjq.cizomxa
  • 08-4408300

  • infofoqd.skfwefidexen@qredpfrinongojtorln.ossenl
  • +46 8 440 83 00